Relaxin & Relaxin-Related Peptides

Insulin-like 3 Peptide (INSL 3)

Relaxin Evolution

GSS: Relaxin Like Peptide

Catalog #	B-035-27
Standard Size	20 µg
Sequence	Biotinyl - (AAATNPARYCCLSGCTQQDLLTLCPY PTPEMREKLCGHHFVRALVRVCGGPRWSTEA)
Species	Human
M.W	6517.7
Mass Spec Analysis	Exhibits correct M.W.
Solubility	Dissolve peptide with 10-20 µl of 60% Acetonitrile in water with 0.1% TFA or with 10-20 µl of DMSO, then dilute with any desired buffer.
Storage Condition	Store peptide in DRY form at 0-5oC.
Appearance	White powder
Content	The contents of this vial have been accurately determined to contain 20µg of NET peptide.
HPLC Analysis	Purity ≥95%

Please click here or click the reference tab on the top to see more articles that use this product.

For best results and reproducibility, rehydrate peptide just before use.
Do not refreeze any unused portions.
Do not attempt to weigh out smaller portions.