INSL 6 (Mouse)

Catalog #	035-46
Standard Size	20 µg
Sequence	A - Chain GFADKCCVIGCTKEEMAVACLPFVDF B - Chain EEEEESRPRKLCGRHLLIEVIKLCGQSDWSR Disulfide Bridge: A Chain:Cys⁶ - Cys¹¹ A Chain Cys⁷ - B Chain Cys¹² A Chain Cys²⁰ - B Chain Cys²⁴
Species	Mouse
M.W	6488.52
Mass Spec Analysis	Exhibits correct M.W.
Solubility	Before reconstitution, please allow 25 to 45 minutes for the lyophilized peptide to return to room temperature. Briefly vortex the Eppendorf tube to concentrate all material at the bottom of the tube. Gently open the cap and reconstitute the peptide to the desired concentration by adding a sterile, aqueous solution to the tube. Invert the tube 5 times by hand to ensure a homogeneous solution.
Storage Condition	Store peptide in DRY form at 0-5°C. For best results and reproducibility, rehydrate peptide just before use. Do not attempt to weigh out smaller portions. Do not refreeze any unused portions.
Appearance	White powder
Content	The contents of this vial have been accurately determined to contain 20µg of NET peptide.
HPLC Analysis	Purity ≥90%

Alphabet_I_

Please click here or click the reference tab on the top to see more articles that use this product.

Links to publications that use this peptide:

Bogatcheva et al. GREAT/LGR8 is the only receptor for insulin-like 3 peptide.
Mol Endocrinol. 2003 Dec;17(12):2639-46.