Relaxin & Relaxin-Related Peptides

Insulin-like 6 Peptide (INSL 6)

Relaxin Evolution

GSS: Relaxin Like Peptide

Catalog #	035-30
Standard Size	100 µg
Sequence	A - Chain: GYSEKCCLTGCTKEELSIACLPYIDF B - Chain: ELSDISSARKLCGRYLVKEIEKLCGHANWSQFR Disulfide Bridge: A Chain:Cys6 - Cys11 A Chain Cys7 - B Chain Cys12 A Chain Cys20 - B Chain Cys24
Species	Human
M.W	6715.76
Mass Spec Analysis	Exhibits correct M.W.
Solubility	Before reconstitution, please allow 25 to 45 minutes for the lyophilized peptide to return to room temperature. Briefly vortex the Eppendorf tube to concentrate all material at the bottom of the tube. Gently open the cap and reconstitute the peptide to the desired concentration by adding a sterile, aqueous solution to the tube. Invert the tube 5 times by hand to ensure a homogeneous solution.
Storage Condition	Store peptide in DRY form at 0-5°C.
Appearance	White powder
Content	This vial contains 100µg of NET peptide.
HPLC Analysis	Purity ≥90%
Additional articles	For best results and reproducibility, rehydrate peptide just before use. Do not attempt to weigh out smaller portions. Do not refreeze any unused portions.

Please click here or click the reference tab on the top to see more articles that use this product.

Links to publications that use this peptide:

El-Shewy et al. The Insulin-like Growth Factor Type 1 and Insulin-like Growth Factor Type 2/Mannose-6-phosphate Receptors Independently Regulate ERK1/2 Activity in HEK293 Cells
J Biol Chem. 2007 Sep 7;282(36):26150-7.

Liu et al. Identification of relaxin-3/INSL7 as an endogenous ligand for the orphan G-protein-coupled receptor GPCR135.
J Biol Chem. 2003 Dec 12;278(50):50754-64.

Liu et al. Identification of relaxin-3/INSL7 as a ligand for GPCR142.
J Biol Chem. 2003 Dec 12;278(50):50765-70.

For best results and reproducibility, rehydrate peptide just before use. Do not attempt to weigh out smaller portions. Do not refreeze any unused portions.