Brain Natriuretic Peptides (BNP)

Normal Plasma Peptide/Protein Levels

Catalog #	011-42
Standard Size	20 µg
Sequence	HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEP - LQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
Species	Human
M.W	8457.5
Mass Spec Analysis	Exhibits correct M.W.
Solubility	Before reconstitution, please allow 25 to 45 minutes for the lyophilized peptide to return to room temperature. Briefly vortex the Eppendorf tube to concentrate all material at the bottom of the tube. Gently open the cap and reconstitute the peptide to the desired concentration by adding a sterile, aqueous solution to the tube. Invert the tube 5 times by hand to ensure a homogeneous solution.
Storage Condition	Store peptide in DRY form at 0-5°C.
Appearance	White powder
Content	The contents of this vial have been accurately determined to contain 20µg of NET peptide.
HPLC Analysis	Purity ≥95%
Additional articles	For best results and reproducibility, rehydrate peptide just before use. Do not attempt to weigh out smaller portions. Do not refreeze any unused portions.

Please click here or click the reference tab on the top to see more articles that use this product.

Links to publications that use this peptide:

Heublein et al. Immunoreactivity and Guanosine 3',5'-Cyclic Monophosphate Activating Actions of Various Molecular Forms of Human B-Type Natriuretic Peptide
Hypertension. 2007 May;49(5):1114-9.

Liang et al. Evidence for Functional Heterogeneity of Circulating B-Type Natriuretic Peptide
J Am Coll Cardiol. 2007 Mar 13;49(10):1071-8.

For best results and reproducibility, rehydrate peptide just before use. Do not attempt to weigh out smaller portions. Do not refreeze any unused portions.