Nesfatin-1 (1-82) (Human)

Catalog #	003-26
Standard Size	20 µg
Sequence	VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
Species	Human
M.W	9551.86
Mass Spec Analysis	Exhibits correct M.W.
Solubility	Before reconstitution, please allow 25 to 45 minutes for the lyophilized peptide to return to room temperature. Briefly vortex the Eppendorf tube to concentrate all material at the bottom of the tube. Gently open the cap and reconstitute the peptide to the desired concentration by adding a sterile, aqueous solution to the tube. Invert the tube 5 times by hand to ensure a homogeneous solution.
Storage Condition	Store peptide in DRY form at 0-5°C. For best results and reproducibility, rehydrate peptide just before use. Do not attempt to weigh out smaller portions. Do not refreeze any unused portions.
Appearance	White powder
Content	The contents of this vial have been accurately determined to contain 20mg of NET peptide.
HPLC Analysis	Purity ≥95%

Alphabet_H_

Please click here or click the reference tab on the top to see more articles that use this product.

Links to publications that use this peptide:

Ramanjaneya et al. Identification of Nesfatin-1 in Human and Murine Adipose Tissue: A Novel Depot-Specific Adipokine with Increased Levels in Obesity.
Endocrinology. 2010 Apr 28. [Epub ahead of print]

Price et al. Permeability of the blood–brain barrier to a novel satiety molecule nesfatin
Peptides. 2007 Dec;28(12):2372-81.