Parathyroid Hormone and its Related Protein

Catalog #	FG-055-12A
Standard Size	1 nmol
Sequence	Di - FAM - (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN - FVALG)
Species	Human
M.W	5174.2
Solubility	Soluble in 50mM sodium phosphate buffer (pH 8.5) or 10% DMSO in PBS buffer (pH 7.5).
Storage Condition	-20°C freezer storage with desiccant.
Contents	The content of this vial has been accurately determined to contain 1.0 nmole of NET peptide.
Absorption	Maximum: 495 nm Extinction: 77, 400 cm-1M-1
Fluorescent_Dye	Mono-5-(and-6)-carboxyfluorescein (FAM)
Emission_maximum	519 nm

Please click here or click the reference tab on the top to see more articles that use this product.

For best results and reproducibility, rehydrate peptide just before use. Do not re-freeze any unused portion.
Protect the Fluorescent Peptide from light, especially in solution.