Nesfatin-1, 2, 3

Catalog #	FG-003-22A
Standard Size	1 nmol
Sequence	n - Fam - (VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLK - QVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRT - RLDEL)
Species	Rat
M.W	~12K
Solubility	Soluble in 50mM sodium phosphate buffer (pH 8.5) or 10% DMSO in PBS buffer (pH 7.5).
Storage Condition	Store at -20°C with desiccant.
Contents	The content of this vial has been accurately determined to contain 1.0 nmole of NET peptide.
Absorption	Maximum: 495 nm, Extinction: 77, 400 cm -1 M -1
Fluorescent_Dye	Mono-5-(and-6)-carboxyfluorescein (FAM)
Emission_maximum	519 nm

Please click here or click the reference tab on the top to see more articles that use this product.

For best results and reproducibility, rehydrate peptide just before
use. Do not refreeze any unused portions.

Protect the fluorescent peptide from light, especially in solution.